PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016479068.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 333aa    MW: 37326.1 Da    PI: 6.8783
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016479068.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.58.2e-153779145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     rg+++ +E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
   XP_016479068.1 37 RGSFSHQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 79
                     899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-51730IPR009057Homeodomain-like
SuperFamilySSF466895.56E-201786IPR009057Homeodomain-like
PROSITE profilePS500904.0541831IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.3E-243186IPR009057Homeodomain-like
PROSITE profilePS5129424.713286IPR017930Myb domain
SMARTSM007171.0E-143684IPR001005SANT/Myb domain
PfamPF002491.4E-133780IPR001005SANT/Myb domain
CDDcd001671.25E-103979No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MDAIQYFCHE TVKKGLQRCG KSCRLRWINY LRPDLKRGSF SHQEAALIIE LHSILGNRWA  60
QIAKHLPGRT DNEVKNFWNS SIKKKLLSHG TLSDFSMIFP NNLTTTSPNP SFDNFYPLNS  120
TPINSIPIST NSPLILQVDH QMNNNHLNAD LNLNPVVPSL INPLSFDSIS NDPTWFNFNY  180
PHPQHDLDYN QNVLKQDNSN SMLTSNISLN YTNGENFMDS RNAAIKTHQD LLMVPLLPKL  240
SEMIKGNGGI VESSPPAASQ QIESMVGSSL PCTFPNGYIH PHYGMNGVHE MEQIECMHMS  300
SFPSSSPSSS KSSPSSCNTQ FMMNPSLPTS WES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25188640108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755155e-51HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795898.10.0PREDICTED: transcription factor MYB86 isoform X2
RefseqXP_016479068.10.0PREDICTED: transcription factor MYB26-like isoform X2
TrEMBLK4BMX31e-115K4BMX3_SOLLC; Uncharacterized protein
STRINGSolyc03g121740.1.11e-114(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.24e-46myb domain protein 26